powered by:
Protein Alignment jdp and CG32727
DIOPT Version :9
Sequence 1: | NP_651807.1 |
Gene: | jdp / 43630 |
FlyBaseID: | FBgn0027654 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_727185.1 |
Gene: | CG32727 / 318176 |
FlyBaseID: | FBgn0265265 |
Length: | 122 |
Species: | Drosophila melanogaster |
Alignment Length: | 38 |
Identity: | 13/38 - (34%) |
Similarity: | 16/38 - (42%) |
Gaps: | 9/38 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 HCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQ 60
|.|.|.|| .||.:.|..|| |..|...:|:
Fly 94 HPDRNGSP--------YLAGKIHKPKN-GLLEGRNRFR 122
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
jdp | NP_651807.1 |
DnaJ |
17..79 |
CDD:278647 |
13/38 (34%) |
CG32727 | NP_727185.1 |
DnaJ |
<34..115 |
CDD:295354 |
11/29 (38%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2214 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.