DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and Dnajc12

DIOPT Version :9

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_038916.1 Gene:Dnajc12 / 30045 MGIID:1353428 Length:198 Species:Mus musculus


Alignment Length:211 Identity:75/211 - (35%)
Similarity:103/211 - (48%) Gaps:32/211 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VDAIINYKRSPNEDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKET 68
            :|||:||:...:||:|.||.|||.||.|||.||:|:.||:.||||:..:.:|...||:|::|||.
Mouse     1 MDAILNYRPEGSEDYYALLGCDELSSVEQILAEFKIRALECHPDKHPENSKAVETFQKLQKAKEI 65

  Fly    69 LCDPEKRAIYDKWRNSGISMSYKQWLGMKEHVGQVRRYTIAEKVDKESMHWVTPKTKDRMLPETG 133
            ||:.|.||.||.||.|.:||.::||..:.:.|             |.||||.....||.||..:|
Mouse    66 LCNAESRARYDHWRRSQMSMPFEQWEALADSV-------------KTSMHWAVRSKKDLMLEGSG 117

  Fly   134 GAAAQGPGTGAGCSSGGLTAASP--NPAHRRASE----------------GGAALYYGSRKGEWG 180
            ......................|  ||...:..|                |.:.|..|..:..|.
Mouse   118 QTFTSSVPNKERSEQRETKKGDPDSNPEKMKQKEPKFPEEGISPQNPDSPGLSDLNCGHLRFRWS 182

  Fly   181 GE-NTDVANKFRNYEI 195
            |: .:::..|||||||
Mouse   183 GDAPSELLRKFRNYEI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:278647 33/61 (54%)
Dnajc12NP_038916.1 DnaJ 14..76 CDD:278647 33/61 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..177 8/62 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9237
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8492
Inparanoid 1 1.050 119 1.000 Inparanoid score I4777
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006991
OrthoInspector 1 1.000 - - oto92891
orthoMCL 1 0.900 - - OOG6_107046
Panther 1 1.100 - - LDO PTHR44500
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4046
SonicParanoid 1 1.000 - - X5078
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.