powered by:
Protein Alignment jdp and Dnajc15
DIOPT Version :9
Sequence 1: | NP_651807.1 |
Gene: | jdp / 43630 |
FlyBaseID: | FBgn0027654 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001099520.1 |
Gene: | Dnajc15 / 290370 |
RGDID: | 1307154 |
Length: | 149 |
Species: | Rattus norvegicus |
Alignment Length: | 49 |
Identity: | 12/49 - (24%) |
Similarity: | 23/49 - (46%) |
Gaps: | 4/49 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 LLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETL 69
:|....::...:|:..:|.:.:..||||......| .::.|||:.|
Rat 98 ILGVSPSAGKAKIRTAHKRIMILNHPDKGGSPYLA----SKINEAKDLL 142
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
jdp | NP_651807.1 |
DnaJ |
17..79 |
CDD:278647 |
12/49 (24%) |
Dnajc15 | NP_001099520.1 |
DnaJ |
39..142 |
CDD:413365 |
11/47 (23%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2214 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.