DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and CG30156

DIOPT Version :10

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_724520.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster


Alignment Length:79 Identity:24/79 - (30%)
Similarity:41/79 - (51%) Gaps:3/79 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVDAIINYKRSPNEDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEA 65
            :..:|.:....|..|.  |.:|....:::..:::..|..|||:.|||||. ...||..|:::.||
  Fly    82 LEMLDVVQKVLRCRNH--YEVLRISHHATYSEVKRAYHKLALRLHPDKNK-SPGAEQAFRRISEA 143

  Fly    66 KETLCDPEKRAIYD 79
            .:.|.|.:||..|:
  Fly   144 ADCLTDCQKRIEYN 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:395170 20/61 (33%)
CG30156NP_724520.1 PRK14296 95..>227 CDD:237666 22/66 (33%)
DnaJ 96..157 CDD:395170 21/63 (33%)
DUF1977 238..334 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.