DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment jdp and DNAJC9

DIOPT Version :9

Sequence 1:	NP_651807.1	Gene:	jdp / 43630	FlyBaseID:	FBgn0027654	Length:	195	Species:	Drosophila melanogaster
Sequence 2:	NP_056005.1	Gene:	DNAJC9 / 23234	HGNCID:	19123	Length:	260	Species:	Homo sapiens

Alignment Length:	130	Identity:	33/130 - (25%)
Similarity:	55/130 - (42%)	Gaps:	29/130 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly    17 DFYGLLHCDENSSPEQIQAEYKVLALQYHPDK-NSGDKE-AEAKFQQLKEAKETLCDPEKRAIYD 79
            |.|.:|.....:|..:::..|..::||.|||: ..|||| |..:||.|.:....|.|.|:||:||
Human    15 DLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYD 79

  Fly    80 K--------------------WR-------NSGISMSYKQWLGMKEHVGQVRRYTIAEKVDKESM 117
            :                    ||       ...|....|.:.|.:|.:..:::..:..|.|.:.:
Human    80 EQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQI 144

Fly 118 117
Human 145 144

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
jdp	NP_651807.1	DnaJ	17..79	CDD:278647	23/63 (37%)
DNAJC9	NP_056005.1	DnaJ	15..79	CDD:278647	23/63 (37%)
DNAJC9	NP_056005.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	185..208
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2214
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900