DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and F54F2.9

DIOPT Version :10

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_498949.2 Gene:F54F2.9 / 176241 WormBaseID:WBGene00018836 Length:414 Species:Caenorhabditis elegans


Alignment Length:157 Identity:38/157 - (24%)
Similarity:65/157 - (41%) Gaps:45/157 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETLCDPEKRAIYD-- 79
            :||.......::|..|::..|:.|.|::|||:||. .:|..||:|:....|.|...|.|..||  
 Worm    35 NFYEWFDIPRDASSNQVKKAYRKLTLEWHPDRNSA-PDATEKFRQVAGIYEVLKTTELREKYDNV 98

  Fly    80 ------KWRN--------------SGI----------------SMSYKQWLGMKEHVGQVRRY-- 106
                  .||:              .||                :..:::.|..|::|.:.|:.  
 Worm    99 LENGLPSWRHPMYYYRRMRKLAWYEGILVLLFIGTIAHYLMMWAAYFEKTLVYKQNVKKSRKSKK 163

  Fly   107 ---TIAEKVDKESMHWVTPKTKDRMLP 130
               ..|||:.|:::....||..: :||
 Worm   164 EDPAEAEKLMKQALEEYLPKYSE-LLP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:395170 20/61 (33%)
F54F2.9NP_498949.2 DnaJ 35..96 CDD:395170 20/61 (33%)
SANT 357..402 CDD:238096
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.