powered by:
Protein Alignment jdp and dnj-21
DIOPT Version :9
Sequence 1: | NP_651807.1 |
Gene: | jdp / 43630 |
FlyBaseID: | FBgn0027654 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_491662.1 |
Gene: | dnj-21 / 172231 |
WormBaseID: | WBGene00001039 |
Length: | 112 |
Species: | Caenorhabditis elegans |
Alignment Length: | 42 |
Identity: | 11/42 - (26%) |
Similarity: | 22/42 - (52%) |
Gaps: | 1/42 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 NSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKET 68
::.|.:|:..:|.:.:..|||: .|.....||..:.|:..|:
Worm 69 SAKPAKIKEAHKKVMIVNHPDR-GGSPYLAAKINEAKDLMES 109
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
jdp | NP_651807.1 |
DnaJ |
17..79 |
CDD:278647 |
11/42 (26%) |
dnj-21 | NP_491662.1 |
DnaJ |
6..107 |
CDD:295354 |
10/38 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2214 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.