powered by:
Protein Alignment jdp and DNAJC19
DIOPT Version :9
Sequence 1: | NP_651807.1 |
Gene: | jdp / 43630 |
FlyBaseID: | FBgn0027654 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_660304.1 |
Gene: | DNAJC19 / 131118 |
HGNCID: | 30528 |
Length: | 116 |
Species: | Homo sapiens |
Alignment Length: | 47 |
Identity: | 12/47 - (25%) |
Similarity: | 22/47 - (46%) |
Gaps: | 1/47 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 LLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKE 67
:|.....::..:|:..::.:.|..|||| .|.....||..:.|:..|
Human 66 ILGVSPTANKGKIRDAHRRIMLLNHPDK-GGSPYIAAKINEAKDLLE 111
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
jdp | NP_651807.1 |
DnaJ |
17..79 |
CDD:278647 |
12/47 (26%) |
DNAJC19 | NP_660304.1 |
DnaJ |
<53..110 |
CDD:413365 |
11/44 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2214 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.