DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and LOC1271995

DIOPT Version :10

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_310857.6 Gene:LOC1271995 / 1271995 VectorBaseID:AGAMI1_006747 Length:536 Species:Anopheles gambiae


Alignment Length:96 Identity:29/96 - (30%)
Similarity:51/96 - (53%) Gaps:5/96 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NEDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETLCDPEKRAIYD 79
            ||:||.||:.::.::..:|:..::.|::..||||:..: :|..:|:.|....|.|.||.:|..||
Mosquito    40 NENFYTLLNINQTATLAEIKRAFRTLSVVLHPDKSDAE-DANIRFRNLVSVYEVLKDPGRREKYD 103

  Fly    80 KWRNSGISMSYKQWLGMKEHVGQVRRYTIAE 110
            |....|:    ..|.....:...||:..:||
Mosquito   104 KVLKEGM----PNWKSALYYYRHVRKMGMAE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:395170 18/61 (30%)
LOC1271995XP_310857.6 None

Return to query results.
Submit another query.