DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and Dnajc9

DIOPT Version :9

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_598842.1 Gene:Dnajc9 / 108671 MGIID:1915326 Length:259 Species:Mus musculus


Alignment Length:130 Identity:29/130 - (22%)
Similarity:54/130 - (41%) Gaps:29/130 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEA--KFQQLKEAKETLCDPEKRAIYD 79
            |.|.:|.....:|..:::..|..::||.|||:...|::.:|  :||.|......|.|.|::|:||
Mouse    15 DLYQVLGVRREASDGEVRRGYHKVSLQVHPDRVEEDQKEDATRRFQILGRVYAVLSDKEQKAVYD 79

  Fly    80 K--------------------WR-------NSGISMSYKQWLGMKEHVGQVRRYTIAEKVDKESM 117
            :                    ||       ...|....|.:.|.:|.:..:::..:..|.|.:.:
Mouse    80 EQGTVDEDSAGLNQDRDWDAYWRLLFKKISLEDIQAFEKTYKGSEEELNDIKQAYLDFKGDMDQI 144

  Fly   118  117
            Mouse   145  144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:278647 19/63 (30%)
Dnajc9NP_598842.1 DnaJ 15..79 CDD:278647 19/63 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.