DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and dnajc12

DIOPT Version :9

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_002936903.1 Gene:dnajc12 / 100493658 XenbaseID:XB-GENE-989011 Length:187 Species:Xenopus tropicalis


Alignment Length:206 Identity:73/206 - (35%)
Similarity:100/206 - (48%) Gaps:33/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VDAIINYKRSPNEDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKET 68
            :|:|.|.. |...|:|.||.|||.|:.|||.|||||.||:.||||:.|:|:|...||:|::||||
 Frog     1 MDSIGNCS-SMEPDYYSLLGCDELSTVEQILAEYKVRALECHPDKHPGNKKAVEDFQRLQQAKET 64

  Fly    69 LCDPEKRAIYDKWRNSGISMSYKQWLGMKEHVGQVRRYTIAEKVDKESMHWVTPKTKDRMLPETG 133
            |.:.|.||.||:||.|.|.:.:.||..:::.|             |.||||.....|:.||....
 Frog    65 LTNEESRAHYDQWRRSKILIPFPQWEALQDSV-------------KTSMHWAVQSKKEPMLEAPN 116

  Fly   134 GAAAQGPG-TGAGC------------SSGGLTAASPNPAHRRASEGGAALYYGSRKGEWGGE-NT 184
            ....:.|. ..:.|            |.......||     ::.|......|...:..|..| .:
 Frog   117 ADPFKMPDKVSSTCDDKKNQSDLMDKSQEDDEVLSP-----KSPEESVDTPYNLLRFRWSAEAPS 176

  Fly   185 DVANKFRNYEI 195
            |:..|||||:|
 Frog   177 DLLRKFRNYDI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:278647 36/61 (59%)
dnajc12XP_002936903.1 DnaJ 13..75 CDD:365959 36/61 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8775
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8492
Inparanoid 1 1.050 104 1.000 Inparanoid score I4816
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1499433at2759
OrthoFinder 1 1.000 - - FOG0006991
OrthoInspector 1 1.000 - - oto103156
Panther 1 1.100 - - LDO PTHR44500
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5078
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.070

Return to query results.
Submit another query.