DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9698 and AT1G20270

DIOPT Version :9

Sequence 1:NP_651806.2 Gene:CG9698 / 43629 FlyBaseID:FBgn0039784 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:210 Identity:59/210 - (28%)
Similarity:99/210 - (47%) Gaps:27/210 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 EELFQDPLLVLYHDVIYQSEIDVIRKLTENRLMRATI--TSHNESVVSNVRTSQFTFIPVTAHKV 389
            |.|..:|...:||:.:.:.|.:.:..|.:..::::|:  :...:|..|.||||..||:.....|:
plant    77 EVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVDSETGKSKDSRVRTSSGTFLRRGRDKI 141

  Fly   390 LSTIDQRVADMTNLNMKYAEDHQFANYGIGGHYGQHMDWFYQTTFDAGLVSSPEMGNRIATVLFY 454
            :.||::|:||.|.:...:.|..|..:|..|..|..|.|:|...      .::...|.|:||:|.|
plant   142 IKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDE------FNTKNGGQRMATMLMY 200

  Fly   455 LSDVAQGGGTAFPQLR-------------------TLLKPKKYAAAFWHNLHASGVGDVRTQHGA 500
            ||||.:||.|.||...                   ..:||:...|..:.::......|..:.||.
plant   201 LSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPTSLHGG 265

  Fly   501 CPIIAGSKWVQNRWI 515
            ||:|.|:||...:|:
plant   266 CPVIRGNKWSSTKWM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9698NP_651806.2 P4Ha_N 28..159 CDD:285528
P4Hc 345..516 CDD:214780 54/192 (28%)
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 58/208 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 1 0.900 - - OOG6_100878
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.820

Return to query results.
Submit another query.