DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9698 and AT4G35820

DIOPT Version :9

Sequence 1:NP_651806.2 Gene:CG9698 / 43629 FlyBaseID:FBgn0039784 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:291 Identity:74/291 - (25%)
Similarity:117/291 - (40%) Gaps:84/291 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 DTYQELIGIQSA----SEEHAKNYETFLNALSEKALLNESKPILEHAPIPEEGEPVGEFQAYSLT 292
            :|:.||:|.|.:    .||..|          :..||....|:|.                 :||
plant    33 NTFDELVGEQVSVDVKIEEKTK----------DMILLCSLSPLLT-----------------TLT 70

  Fly   293 CSGHWRLTPKEQRHLRCGYVTETHPFLWIAPLKAEELFQDPLLVLYHDVI--------YQSEIDV 349
            ||     ..|....||  :..|.    |:     |.:.::|...:||:.:        ...|.|.
plant    71 CS-----MVKVAASLR--FPNER----WL-----EVITKEPRAFVYHNFLALFFKICKTNEECDH 119

  Fly   350 IRKLTENRLMRA----TITSHNESVVSNVRTSQFTFIPVTAHKVLSTIDQRVADMTNLNMKYAED 410
            :..|.:..:.|:    .:|...|.  |:.|||..|||.....|::..|::|:::.|.:..:..|.
plant   120 LISLAKPSMARSKVRNALTGLGEE--SSSRTSSGTFIRSGHDKIVKEIEKRISEFTFIPQENGET 182

  Fly   411 HQFANYGIGGHYGQHMDWFYQTTFDAGLVSSPEMGNRIATVLFYLSDVAQGGGTAFPQLRTL--- 472
            .|..||.:|..:..|.|.|                .||||||.|||||.:||.|.||:.:.:   
plant   183 LQVINYEVGQKFEPHFDGF----------------QRIATVLMYLSDVDKGGETVFPEAKGIKSK 231

  Fly   473 ----LKPKKYAAAFWHNLHASGVGDVRTQHG 499
                ::|||..|..:.::...|..|..::||
plant   232 KGVSVRPKKGDALLFWSMRPDGSRDPSSKHG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9698NP_651806.2 P4Ha_N 28..159 CDD:285528
P4Hc 345..516 CDD:214780 49/166 (30%)
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927 17/75 (23%)
P4Hc 115..262 CDD:214780 47/164 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.