DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9698 and AT4G35810

DIOPT Version :9

Sequence 1:NP_651806.2 Gene:CG9698 / 43629 FlyBaseID:FBgn0039784 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001320148.1 Gene:AT4G35810 / 829735 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana


Alignment Length:222 Identity:63/222 - (28%)
Similarity:104/222 - (46%) Gaps:34/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 WIAPLKAEELFQDPLLVLYHDVIYQSEIDVIRKLTENRLMRATI--TSHNESVVSNVRTSQFTFI 382
            |:     |.:..:|...:||:.:...|.:.:..|.:..:|::.:  ....:|:.|.||||..||:
plant    79 WL-----EVISWEPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDVKTGKSIDSRVRTSSGTFL 138

  Fly   383 PVTAHKVLSTIDQRVADMTNLNMKYAEDHQFANYGIGGHYGQHMDWFYQTTFDAGLVSSPEMGNR 447
            .....:::..|:.|::|.|.:..:..|..|..:|.:|..|..|.|:|    ||...|.  :.|.|
plant   139 NRGHDEIVEEIENRISDFTFIPPENGEGLQVLHYEVGQRYEPHHDYF----FDEFNVR--KGGQR 197

  Fly   448 IATVLFYLSDVAQGGGTAFPQLR--------------------TLLKPKKYAAAFWHNLHASGVG 492
            |||||.|||||.:||.|.||..:                    ::|..|:.|..|| ::......
plant   198 IATVLMYLSDVDEGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFW-SMKPDASL 261

  Fly   493 DVRTQHGACPIIAGSKWVQNRWIREND 519
            |..:.||.||:|.|:||...:|...::
plant   262 DPSSLHGGCPVIKGNKWSSTKWFHVHE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9698NP_651806.2 P4Ha_N 28..159 CDD:285528
P4Hc 345..516 CDD:214780 58/192 (30%)
AT4G35810NP_001320148.1 PLN00052 75..289 CDD:177683 63/222 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 1 0.900 - - OOG6_100878
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.820

Return to query results.
Submit another query.