DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9698 and AT3G28490

DIOPT Version :9

Sequence 1:NP_651806.2 Gene:CG9698 / 43629 FlyBaseID:FBgn0039784 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_189490.2 Gene:AT3G28490 / 822479 AraportID:AT3G28490 Length:288 Species:Arabidopsis thaliana


Alignment Length:242 Identity:73/242 - (30%)
Similarity:110/242 - (45%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 IAPLKAEELFQDPLLVLYHDVIYQSEIDVIRKLTENRLMRATITS---HNESVVSNVRTSQFTFI 382
            :.|.:..:|...|...||...:...|.|.:.||.:.:|.::.:.:   ..||..|.||||...|:
plant    27 VDPTRITQLSWTPRAFLYKGFLSDEECDHLIKLAKGKLEKSMVVADVDSGESEDSEVRTSSGMFL 91

  Fly   383 PVTAHKVLSTIDQRVADMTNLNMKYAEDHQFANYGIGGHYGQHMDWFY-QTTFDAGLVSSPEMGN 446
            ......:::.::.::|..|.|..:..|..|..:|..|..|..|.|:|| :...:.|       |:
plant    92 TKRQDDIVANVEAKLAAWTFLPEENGEALQILHYENGQKYDPHFDYFYDKKALELG-------GH 149

  Fly   447 RIATVLFYLSDVAQGGGTAF-------PQLRT-----------LLKPKKYAAAFWHNLHASGVGD 493
            ||||||.|||:|.:||.|.|       |||:.           .:||:|..|..:.|||.:|..|
plant   150 RIATVLMYLSNVTKGGETVFPNWKGKTPQLKDDSWSKCAKQGYAVKPRKGDALLFFNLHLNGTTD 214

  Fly   494 VRTQHGACPIIAGSKWVQNRWIREND--------QSDRRPCELWDDS 532
            ..:.||:||:|.|.||...|||....        ..|...|:.|.|:
plant   215 PNSLHGSCPVIEGEKWSATRWIHVRSFGKKKLVCVDDHESCQEWADA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9698NP_651806.2 P4Ha_N 28..159 CDD:285528
P4Hc 345..516 CDD:214780 63/192 (33%)
AT3G28490NP_189490.2 PLN00052 28..288 CDD:177683 73/241 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 1 0.900 - - OOG6_100878
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.