DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9698 and P4H2

DIOPT Version :9

Sequence 1:NP_651806.2 Gene:CG9698 / 43629 FlyBaseID:FBgn0039784 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:244 Identity:76/244 - (31%)
Similarity:109/244 - (44%) Gaps:42/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 IAPLKAEELFQDPLLVLYHDVIYQSEIDVIRKLTENRLMRATITSHN--ESVVSNVRTSQFTFIP 383
            |.|.|.:::...|...:|...:...|.|.:..|.:..|.|:.:..::  ||.||:||||..|||.
plant    33 INPSKVKQVSSKPRAFVYEGFLTDLECDHLISLAKENLQRSAVADNDNGESQVSDVRTSSGTFIS 97

  Fly   384 VTAHKVLSTIDQRVADMTNLNMKYAEDHQFANYGIGGHYGQHMDWFYQTTFDAGLVSSPEMGNRI 448
            .....::|.|:.:::..|.|..:..||.|...|..|..|..|.|:|:..      |:....|:||
plant    98 KGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHGQKYDAHFDYFHDK------VNIARGGHRI 156

  Fly   449 ATVLFYLSDVAQGGGTAFPQL-----RTL----------------LKPKKYAAAFWHNLHASGVG 492
            ||||.|||:|.:||.|.||..     |:|                :||||..|..:.||....:.
plant   157 ATVLLYLSNVTKGGETVFPDAQEFSRRSLSENKDDLSDCAKKGIAVKPKKGNALLFFNLQQDAIP 221

  Fly   493 DVRTQHGACPIIAGSKWVQNRWIRENDQSDR------------RPCELW 529
            |..:.||.||:|.|.||...:||.. |..|:            ..||.|
plant   222 DPFSLHGGCPVIEGEKWSATKWIHV-DSFDKILTHDGNCTDVNESCERW 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9698NP_651806.2 P4Ha_N 28..159 CDD:285528
P4Hc 345..516 CDD:214780 65/193 (34%)
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 65/195 (33%)
ShKT 259..299 CDD:214586 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.