DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9698 and AT-P4H-1

DIOPT Version :9

Sequence 1:NP_651806.2 Gene:CG9698 / 43629 FlyBaseID:FBgn0039784 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_181836.1 Gene:AT-P4H-1 / 818910 AraportID:AT2G43080 Length:283 Species:Arabidopsis thaliana


Alignment Length:220 Identity:58/220 - (26%)
Similarity:100/220 - (45%) Gaps:23/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 LWIAPLKAEELFQDPLLVLYHDVIYQSEIDVIRKLTENRLMRATI--TSHNESVVSNVRTSQFTF 381
            |.|..:|.|.:...|.:::.||.:...|.:.::.:...||..:|:  ....:.|.|:||||...|
plant    70 LRIGNVKPEVVSWSPRIIVLHDFLSPEECEYLKAIARPRLQVSTVVDVKTGKGVKSDVRTSSGMF 134

  Fly   382 IP--VTAHKVLSTIDQRVADMTNLNMKYAEDHQFANYGIGGHYGQHMDWFYQTTFDAGLVSSPEM 444
            :.  ..::.::..|::|:|..:.:..:..|..|...|.....|..|.|:|..|      .:....
plant   135 LTHVERSYPIIQAIEKRIAVFSQVPAENGELIQVLRYEPQQFYKPHHDYFADT------FNLKRG 193

  Fly   445 GNRIATVLFYLSDVAQGGGTAFP-------------QLRTLLKPKKYAAAFWHNLHASGVGDVRT 496
            |.|:||:|.||:|..:||.|.||             .....:||.|..|..:.::...|..|.|:
plant   194 GQRVATMLMYLTDDVEGGETYFPLAGDGDCTCGGKIMKGISVKPTKGDAVLFWSMGLDGQSDPRS 258

  Fly   497 QHGACPIIAGSKWVQNRWIRENDQS 521
            .||.|.:::|.||...:|:|:...|
plant   259 IHGGCEVLSGEKWSATKWMRQKATS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9698NP_651806.2 P4Ha_N 28..159 CDD:285528
P4Hc 345..516 CDD:214780 49/187 (26%)
AT-P4H-1NP_181836.1 PLN00052 80..281 CDD:177683 53/206 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.