DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9698 and P4H13

DIOPT Version :9

Sequence 1:NP_651806.2 Gene:CG9698 / 43629 FlyBaseID:FBgn0039784 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:144 Identity:46/144 - (31%)
Similarity:70/144 - (48%) Gaps:21/144 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 VLSTIDQRVADMTNLNMKYAEDHQFANYGIGGHYGQHMDWFYQTTFDAGLVSSPEMGNRIATVLF 453
            ||:.|::::|..|.....|.|......|.:|..|..|.|.|:...:      .|.:..|:.|.|.
plant   133 VLAAIEEKIALATRFPKDYYESFNILRYQLGQKYDSHYDAFHSAEY------GPLISQRVVTFLL 191

  Fly   454 YLSDVAQGGGTAFP--QLRTL-------------LKPKKYAAAFWHNLHASGVGDVRTQHGACPI 503
            :||.|.:||.|.||  ..|.:             :||::..|.|::||..:|..|..:.||:||:
plant   192 FLSSVEEGGETMFPFENGRNMNGRYDYEKCVGLKVKPRQGDAIFFYNLFPNGTIDQTSLHGSCPV 256

  Fly   504 IAGSKWVQNRWIRE 517
            |.|.|||..:|||:
plant   257 IKGEKWVATKWIRD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9698NP_651806.2 P4Ha_N 28..159 CDD:285528
P4Hc 345..516 CDD:214780 44/141 (31%)
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 44/141 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 1 0.900 - - OOG6_100878
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.820

Return to query results.
Submit another query.