DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9698 and p4htmb

DIOPT Version :9

Sequence 1:NP_651806.2 Gene:CG9698 / 43629 FlyBaseID:FBgn0039784 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_001340234.2 Gene:p4htmb / 799930 ZFINID:ZDB-GENE-110131-7 Length:510 Species:Danio rerio


Alignment Length:427 Identity:102/427 - (23%)
Similarity:159/427 - (37%) Gaps:139/427 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 VYRLKAKDLARGILDGVDYGTQLNSEHCVDIARLALRDQHPRLAHSWLIEANDRLTGGEKEEQLK 210
            |:.:|...|...:.:..|:   |:.|.|..:.|||                  :|.|..:.:.:.
Zfish   145 VHEMKTLSLKPLLFEIPDF---LSEEECAVVVRLA------------------QLKGLMESQVMV 188

  Fly   211 PQILALLVQAKKELEDFRGLNDTYQELIGIQSASEEHAKNYETFLNALSEKALLNESKPILEHAP 275
            |       :.::||:  :.||.:.:|:.              .||:       ||:...:..|  
Zfish   189 P-------EGQEELD--QQLNLSPEEIF--------------NFLD-------LNQDGQLQPH-- 221

  Fly   276 IPEEGEPVGEFQAYSLTCSGHWRLTPKEQRHLRCGYVTETHPFLWIAPLKAEELFQDPLLVLYHD 340
                     |...:|....|.| ||.:..:.:..|             ||| :|..:.||.|  :
Zfish   222 ---------EILTHSRVRDGIW-LTSENLKEIYDG-------------LKA-DLDGNGLLSL--E 260

  Fly   341 VIYQSEIDVIRK-LTENRLMRATITSHNESVVSNVRTSQFTFI--PVTAHKVLSTIDQRVADMTN 402
            ...:...|..:: |.:..:.|:.:          ||.|:.|::  ...||:||..:.:||..:|.
Zfish   261 EFGRLRSDAFQRFLLQRGVERSQL----------VRNSRHTWLYQGQGAHQVLQDLRKRVTLLTR 315

  Fly   403 LN---MKYAEDHQFANYGIGGHYGQHMDW--FY------QTTFDAGLVSSPEMGNRIATVLFYLS 456
            |.   ::.:|..|...|..||||..|.|.  .|      .|...|...|..:...|..||||||:
Zfish   316 LPSSLVELSEPLQVVRYEQGGHYHAHHDSGPVYPETACTHTRLAANTTSPFQTSCRYITVLFYLN 380

  Fly   457 DVAQGGGTAFP-----------------------------QLRTLLKPKKYAAAFWHNLHASGVG 492
            :|.:||.|.||                             .||  :||.|..|.||:|..:.|.|
Zfish   381 NVQEGGETTFPVADNRTYEEASLIQNDVDLLDTRKHCDKGNLR--VKPVKGTAVFWYNYLSDGRG 443

  Fly   493 DVRTQ-----HGACPIIAGSKWVQNRWIRENDQSDRR 524
            .|..|     ||.|.:..|:|||.|.||..:....|:
Zfish   444 WVGEQDEYSLHGGCVVTQGTKWVANNWINVDPDYQRQ 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9698NP_651806.2 P4Ha_N 28..159 CDD:285528 3/12 (25%)
P4Hc 345..516 CDD:214780 63/218 (29%)
p4htmbXP_001340234.2 EF-hand_7 204..262 CDD:290234 20/106 (19%)
EFh 204..262 CDD:298682 20/106 (19%)
P4Hc 285..471 CDD:214780 59/187 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583465
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.