DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9698 and p4htma

DIOPT Version :9

Sequence 1:NP_651806.2 Gene:CG9698 / 43629 FlyBaseID:FBgn0039784 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001074160.1 Gene:p4htma / 791209 ZFINID:ZDB-GENE-070112-2222 Length:478 Species:Danio rerio


Alignment Length:358 Identity:73/358 - (20%)
Similarity:114/358 - (31%) Gaps:119/358 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 ELIGIQSASEEHAKNYETFLNALSEKALLNESKPILEHAPIPEEGEPVGEFQAYSL--------- 291
            |:.|..|..|.:.......|..|:..:||..          |::.|.:.:.:.:||         
Zfish   144 EIPGFLSVEESNVVMQLAQLKGLTHSSLLTN----------PDQEEQLTQDELFSLLDLNQDGLL 198

  Fly   292 ----------TCSGHWRLTPKEQRHLRCGYVTETHPFLWIAPLKAEELFQDPLLVLYHDVIYQ-- 344
                      :..|.| |:....|.:..|  .||:|   ...|..:|..:....||.:....|  
Zfish   199 QREEILSLSHSTDGSW-LSSYNLRKIHTG--LETNP---SGVLSLQEFKRVSGGVLRYSGAAQGL 257

  Fly   345 -SEIDVIRKLTENRLMRATITSHNESVVSNVRTSQFTFIPVTAHKVLSTIDQRVADMTNLN---M 405
             ....|.::.|..||                      ::....|.:|.::..||..:|.|.   :
Zfish   258 DGHTKVRQRSTHTRL----------------------YLGEGTHHLLKSVRNRVTRLTRLPSSLV 300

  Fly   406 KYAEDHQFANYGIGGHYGQHMDWFYQTTFDAGLVSSP--------------EMGNRIA----TVL 452
            ..:|..:...|..|.....|.|            |||              ...|::|    |||
Zfish   301 DLSEAMEVVRYEQGVFSHAHHD------------SSPTHPDNSCTHTHLAANTSNQVACRYLTVL 353

  Fly   453 FYLSDVAQGGGTAFP--QLRTL-------------------LKPKKYAAAFWHNLHASGVG---- 492
            .||:....||.|:||  ..||.                   :||....|..|:|..:.|.|    
Zfish   354 LYLNSADSGGETSFPVADNRTYEEEVLGDLSQQYCDKGNLKVKPVAGTALLWYNHLSDGNGWVGE 418

  Fly   493 -DVRTQHGACPIIAGSKWVQNRWIRENDQSDRR 524
             |..:.||.|.:..|.||..:.|:..:....|:
Zfish   419 LDEFSLHGDCLVTRGFKWTGSVWVNIDPDQQRQ 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9698NP_651806.2 P4Ha_N 28..159 CDD:285528
P4Hc 345..516 CDD:214780 47/217 (22%)
p4htmaNP_001074160.1 2OG-FeII_Oxy <272..442 CDD:304390 43/203 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583490
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.