DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9698 and CG34041

DIOPT Version :9

Sequence 1:NP_651806.2 Gene:CG9698 / 43629 FlyBaseID:FBgn0039784 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster


Alignment Length:351 Identity:66/351 - (18%)
Similarity:128/351 - (36%) Gaps:79/351 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 HEMTK-----VFGYEQKMVLHMQKFLSDNQDKLDFLKARL-------REFENERNEAREWGPSYF 82
            |.::|     :...::.:|.:::.::...:.||..:...|       .:||.::       .:..
  Fly   257 HSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATYHIQFERDK-------LAIA 314

  Fly    83 ESPINKYLLNKRLTVDWQRVENLMATSTGEKPLTRLRKFRNRETMPDKKELEGAIDGLLRLQYVY 147
            .||:..|.|...:..||...:..:....|:..|..|...  ::.:|.|.::.....|:.::...|
  Fly   315 SSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSI--KKYLPTKNDISEVCHGISKMLNAY 377

  Fly   148 RLKAKDLARGILDGVDYGTQ-----------------------LNSEHCVDIARLALRDQHPRLA 189
            .:.|:|:|.|::    .|||                       ::...||.::..::..:....:
  Fly   378 LMTAQDIANGVI----LGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKS 438

  Fly   190 HSWLIEANDRLTGGEKEEQLKPQILALLVQAKKELEDFRGLNDTYQELIGIQSASEEHAKNYETF 254
            ..||..|...|......:.:.|..                  |.|.:|..:....:......||.
  Fly   439 KEWLNVAISMLESSAYWDPIVPSA------------------DLYLKLAEVYVKQQNWTLALETV 485

  Fly   255 LNALSEK----ALLNESKPILEHAPIPEEGEPVGEFQAYSLTCSGHWRLTPKEQRHLRCGYVTET 315
            ..||...    .|:...|.:..|..:.....|....:      :..:||  ::...|.|.|.|:.
  Fly   486 EFALKSNPRNAQLIRMQKRLSYHILLGPPKSPKLNIE------NNDYRL--RKNGSLYCFYDTKI 542

  Fly   316 HPFL-WIAPLKAEELFQDPLLVLYHD 340
            ..|. .:||:|||.||.|||::|||:
  Fly   543 RTFYSLLAPIKAEVLFIDPLVILYHE 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9698NP_651806.2 P4Ha_N 28..159 CDD:285528 25/140 (18%)
P4Hc 345..516 CDD:214780
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 24/137 (18%)
TPR repeat 452..491 CDD:276809 8/56 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461975
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.