DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9698 and phy-4

DIOPT Version :9

Sequence 1:NP_651806.2 Gene:CG9698 / 43629 FlyBaseID:FBgn0039784 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001123049.1 Gene:phy-4 / 189869 WormBaseID:WBGene00012815 Length:282 Species:Caenorhabditis elegans


Alignment Length:219 Identity:65/219 - (29%)
Similarity:104/219 - (47%) Gaps:23/219 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 HPFLWIAPLKAEELFQDPLLVLYHDVIYQ-------SEIDVIRKLTENRLMRATITSHNESVVSN 373
            |..|.|.  |.|.|..:|.::.||:.:::       .|.:.:| |.:.::...|.|...    |.
 Worm    56 HKHLLIR--KVEILSSEPFILQYHNQVHRRLAKRAVQEAEALR-LEQLKISGFTTTPEK----SQ 113

  Fly   374 VRTSQFTFIPVTAHKVLSTIDQRV-ADMTNLNMKYAEDHQFANYGIGGHYGQHMDWFYQTTFDAG 437
            ||.:..|::..|.....:.|.:.: |::.:|::..||..|..:|...|:|..|.|:....| :..
 Worm   114 VRAANGTWLIHTGRPSFARIFEGLQANINSLDLSTAEPWQILSYNADGYYAPHYDYLNPAT-NVQ 177

  Fly   438 LVSSPEMGNRIATVLFYLSDVAQGGGTAFPQLRTLLKPKKYAAAFWHNLHASGVGDVRTQHGACP 502
            ||..  .||||||||..|....:||.|.||:|...::||......|.|..::|..:.:|.|.|||
 Worm   178 LVEG--RGNRIATVLVILQIAKKGGTTVFPRLNLNIRPKAGDVIVWLNTLSTGESNSQTLHAACP 240

  Fly   503 IIAGSK-----WVQNRWIRENDQS 521
            |..|:|     ||..:...:|.:|
 Worm   241 IHEGTKIGATLWVHEKIFSQNTKS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9698NP_651806.2 P4Ha_N 28..159 CDD:285528
P4Hc 345..516 CDD:214780 54/176 (31%)
phy-4NP_001123049.1 P4Hc 81..254 CDD:214780 53/180 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.