DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE2 and P4H2

DIOPT Version :9

Sequence 1:NP_733378.1 Gene:PH4alphaNE2 / 43628 FlyBaseID:FBgn0039783 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:223 Identity:67/223 - (30%)
Similarity:101/223 - (45%) Gaps:24/223 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 VTSPFLQLAPIKTEILSIDPFVVLLHDMISQKESTLIRTSSKEHMLPSATTDPDASDDETQVDTY 377
            ::||...:.|.|.:.:|..|...:....::..|...:.:.:||::..||..|.|  :.|:||...
plant    26 ISSPSSIINPSKVKQVSSKPRAFVYEGFLTDLECDHLISLAKENLQRSAVADND--NGESQVSDV 88

  Fly   378 RTSKSVWYSSDFNDTTKKITERLGDATGLDMNSTEFYQVINYGLGGFFETHLDMLLSEKNRFNGT 442
            |||...:.|...:.....|.::|...|.|...:.|..||:.|..|..::.|.|....:.|...| 
plant    89 RTSSGTFISKGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHGQKYDAHFDYFHDKVNIARG- 152

  Fly   443 SDRIATTLFYLNEVRQGGGTYFP---------------------RLNLTVFPQPGSALFWYNLDT 486
            ..||||.|.||:.|.:||.|.||                     :..:.|.|:.|:||.::||..
plant   153 GHRIATVLLYLSNVTKGGETVFPDAQEFSRRSLSENKDDLSDCAKKGIAVKPKKGNALLFFNLQQ 217

  Fly   487 KGNDHMGSLHTGCPVIVGSKWVMSKWIN 514
            .......|||.|||||.|.||..:|||:
plant   218 DAIPDPFSLHGGCPVIEGEKWSATKWIH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE2NP_733378.1 P4Ha_N 33..161 CDD:285528
TPR repeat 175..200 CDD:276809
TPR_16 176..254 CDD:290168
TPR repeat 219..249 CDD:276809
TPR_2 220..253 CDD:285020
P4Hc 342..513 CDD:214780 59/191 (31%)
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 60/192 (31%)
ShKT 259..299 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.