DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE2 and Y43F8B.19

DIOPT Version :9

Sequence 1:NP_733378.1 Gene:PH4alphaNE2 / 43628 FlyBaseID:FBgn0039783 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_001123044.2 Gene:Y43F8B.19 / 6418801 WormBaseID:WBGene00077688 Length:243 Species:Caenorhabditis elegans


Alignment Length:241 Identity:71/241 - (29%)
Similarity:107/241 - (44%) Gaps:47/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 IKTEILSIDPFVVLLHDMISQKESTLIRTSSK--EHML--PSATTDPDASD--------DETQV- 374
            :|.|:::..|.:|:..|:.:.|:   :|...:  ||:.  .....:.|.:|        :.||| 
 Worm    22 VKVEVVAWRPGLVIYRDLFTGKQ---VRDHLELMEHLKFEEQLVVNDDGNDIVSKIRRANGTQVF 83

  Fly   375 -DTYRTSKSVWYSSDFNDTTKKITERLGDATGLDMNSTEFYQVINYGLGGFFETHLDMLL--SEK 436
             :.:..::|:|      ||.|.:...|...|..|:      ..::|..||.:..|.|.||  |||
 Worm    84 HEDHPAARSIW------DTAKNLLPNLNFKTAEDI------LALSYNPGGHYAAHHDYLLYPSEK 136

  Fly   437 N-----RFNGTSDRIATTLFYLNEVRQGGGTYFPRLNLTVFPQPGSALFWYNLDTKGNDHMGSL- 495
            .     |.||  :|..|.:........||.|.||||...|..:||.|.||:|  ..||.....| 
 Worm   137 EWDEWMRVNG--NRFGTLIMAFGAAESGGATVFPRLGAAVRTKPGDAFFWFN--AMGNSEQEDLS 197

  Fly   496 -HTGCPVIVGSKWVMSKWINDMGQEFTRPCVESSLSSNEVLSAERL 540
             |.|||:..|.|.:.:.|:....|    |.:|.:|||:. |||..|
 Worm   198 EHAGCPIYKGQKQISTIWLRMRDQ----PILEQTLSSDS-LSASLL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE2NP_733378.1 P4Ha_N 33..161 CDD:285528
TPR repeat 175..200 CDD:276809
TPR_16 176..254 CDD:290168
TPR repeat 219..249 CDD:276809
TPR_2 220..253 CDD:285020
P4Hc 342..513 CDD:214780 55/193 (28%)
Y43F8B.19NP_001123044.2 P4Hc 43..217 CDD:214780 56/192 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.