DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE2 and phy-4

DIOPT Version :9

Sequence 1:NP_733378.1 Gene:PH4alphaNE2 / 43628 FlyBaseID:FBgn0039783 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_001123049.1 Gene:phy-4 / 189869 WormBaseID:WBGene00012815 Length:282 Species:Caenorhabditis elegans


Alignment Length:223 Identity:63/223 - (28%)
Similarity:109/223 - (48%) Gaps:21/223 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 KTEILSIDPFVVLLHDMISQK-------ESTLIRTSSKEHMLPSATTDPDASDDETQVDTYRTSK 381
            |.||||.:||::..|:.:.::       |:..:|.  ::..:...||.|:.|    ||   |.:.
 Worm    63 KVEILSSEPFILQYHNQVHRRLAKRAVQEAEALRL--EQLKISGFTTTPEKS----QV---RAAN 118

  Fly   382 SVWYSSDFNDTTKKITERL-GDATGLDMNSTEFYQVINYGLGGFFETHLDMLLSEKN--RFNGTS 443
            ..|.......:..:|.|.| .:...||:::.|.:|:::|...|::..|.|.|....|  ...|..
 Worm   119 GTWLIHTGRPSFARIFEGLQANINSLDLSTAEPWQILSYNADGYYAPHYDYLNPATNVQLVEGRG 183

  Fly   444 DRIATTLFYLNEVRQGGGTYFPRLNLTVFPQPGSALFWYNLDTKGNDHMGSLHTGCPVIVGSKWV 508
            :||||.|..|...::||.|.||||||.:.|:.|..:.|.|..:.|..:..:||..||:..|:|..
 Worm   184 NRIATVLVILQIAKKGGTTVFPRLNLNIRPKAGDVIVWLNTLSTGESNSQTLHAACPIHEGTKIG 248

  Fly   509 MSKWINDMGQEFTRPCVESSLSSNEVLS 536
            .:.|:::  :.|::....:.||....|:
 Worm   249 ATLWVHE--KIFSQNTKSTGLSRQNSLA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE2NP_733378.1 P4Ha_N 33..161 CDD:285528
TPR repeat 175..200 CDD:276809
TPR_16 176..254 CDD:290168
TPR repeat 219..249 CDD:276809
TPR_2 220..253 CDD:285020
P4Hc 342..513 CDD:214780 50/180 (28%)
phy-4NP_001123049.1 P4Hc 81..254 CDD:214780 51/181 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.