DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15539 and AT1G20270

DIOPT Version :9

Sequence 1:NP_001036776.1 Gene:CG15539 / 43627 FlyBaseID:FBgn0039782 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:230 Identity:68/230 - (29%)
Similarity:111/230 - (48%) Gaps:33/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 SYFLRLAPLK-----------MELLSLDPYMVLFHDVVSDKDIVSIRNLTKGKLAR-TVTVSKDG 354
            |||.|.|..:           .|:||.:|...::|:.:|.::...:.:|.|..:.: ||..|:.|
plant    55 SYFRRAATERSEGLGKRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVDSETG 119

  Fly   355 NYTEDPDRTTKGTWLVE-NNALIQRLSQLTQDMTNFDIHDADPFQVLNYGIGGFYGIHFD-FLED 417
            ...:...||:.||:|.. .:.:|:.:.:...|.|.......:..|||:|..|..|..|:| |:::
plant   120 KSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDE 184

  Fly   418 AELDNFSDRIATAVFYLSDVPQGGATIFP-------------------KLGLSVFPKKGSALLWY 463
            ....|...|:||.:.|||||.:||.|:||                   |.||||.|:.|.|||::
plant   185 FNTKNGGQRMATMLMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFW 249

  Fly   464 NLDHKGDGDNRTAHSACPTVVGSRWVMTKWINERE 498
            ::......|..:.|..||.:.|::|..|||::..|
plant   250 SMRPDATLDPTSLHGGCPVIRGNKWSSTKWMHVGE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15539NP_001036776.1 P4Ha_N 33..156 CDD:285528
P4Hc 329..494 CDD:214780 56/186 (30%)
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 62/206 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.