DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15539 and AT5G18900

DIOPT Version :9

Sequence 1:NP_001036776.1 Gene:CG15539 / 43627 FlyBaseID:FBgn0039782 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_197391.1 Gene:AT5G18900 / 832008 AraportID:AT5G18900 Length:298 Species:Arabidopsis thaliana


Alignment Length:221 Identity:60/221 - (27%)
Similarity:104/221 - (47%) Gaps:26/221 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 TTSSYFLRLAPLKMELLSLDPYMVLFHDVVSDKDIVSIRNLTKGKLARTVTVSKDGNYTEDPD-R 362
            ::||.|:.  |.|::.:|..|...::...:::.:...:.:|.|..|.|:.....|...::..: |
plant    26 SSSSVFVN--PSKVKQVSSKPRAFVYEGFLTELECDHMVSLAKASLKRSAVADNDSGESKFSEVR 88

  Fly   363 TTKGTWLVE-NNALIQRLSQLTQDMTNFDIHDADPFQVLNYGIGGFYGIHFDFLED-AELDNFSD 425
            |:.||::.: .:.::..:.......|.....:.:..|||.|..|..|..|||:..| ..:.....
plant    89 TSSGTFISKGKDPIVSGIEDKISTWTFLPKENGEDIQVLRYEHGQKYDAHFDYFHDKVNIVRGGH 153

  Fly   426 RIATAVFYLSDVPQGGATIFP---------------------KLGLSVFPKKGSALLWYNLDHKG 469
            |:||.:.|||:|.:||.|:||                     |.|::|.|:||.|||::||....
plant   154 RMATILMYLSNVTKGGETVFPDAEIPSRRVLSENKEDLSDCAKRGIAVKPRKGDALLFFNLHPDA 218

  Fly   470 DGDNRTAHSACPTVVGSRWVMTKWIN 495
            ..|..:.|..||.:.|.:|..||||:
plant   219 IPDPLSLHGGCPVIEGEKWSATKWIH 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15539NP_001036776.1 P4Ha_N 33..156 CDD:285528
P4Hc 329..494 CDD:214780 51/188 (27%)
AT5G18900NP_197391.1 PLN00052 33..298 CDD:177683 57/214 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.