DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15539 and AT4G35820

DIOPT Version :9

Sequence 1:NP_001036776.1 Gene:CG15539 / 43627 FlyBaseID:FBgn0039782 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:304 Identity:74/304 - (24%)
Similarity:135/304 - (44%) Gaps:80/304 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 GLKMYEADEEIEYIYSQLGMPLVDFYELFVEIQDELGSRYLAMSELQLAIKNWPEKVSLQRALSR 257
            |||:||..:.|::|.:        |.||..|                                 :
plant    19 GLKIYETSDLIQHINT--------FDELVGE---------------------------------Q 42

  Fly   258 LKMNIRIGKEPAEKKNKSKRVYKKCCSSECRPTAKLYC-LYKTTSSYFLRLAPLK-MELLSLDPY 320
            :.::::|       :.|:|.:...|..|....|  |.| :.|..:|  ||....: :|:::.:|.
plant    43 VSVDVKI-------EEKTKDMILLCSLSPLLTT--LTCSMVKVAAS--LRFPNERWLEVITKEPR 96

  Fly   321 MVLFHDVV--------SDKDIVSIRNLTKGKLART-VTVSKDGNYTEDPDRTTKGTWLVE-NNAL 375
            ..::|:.:        ::::...:.:|.|..:||: |..:..|...|...||:.||::.. ::.:
plant    97 AFVYHNFLALFFKICKTNEECDHLISLAKPSMARSKVRNALTGLGEESSSRTSSGTFIRSGHDKI 161

  Fly   376 IQRLSQLTQDMTNFDIHDADPFQVLNYGIGGFYGIHFDFLEDAELDNFSDRIATAVFYLSDVPQG 440
            ::.:.:...:.|.....:.:..||:||.:|..:..|||..:         ||||.:.|||||.:|
plant   162 VKEIEKRISEFTFIPQENGETLQVINYEVGQKFEPHFDGFQ---------RIATVLMYLSDVDKG 217

  Fly   441 GATIFP-------KLGLSVFPKKGSALLWYNLDHKGDGDNRTAH 477
            |.|:||       |.|:||.||||.|||::::...|..|..:.|
plant   218 GETVFPEAKGIKSKKGVSVRPKKGDALLFWSMRPDGSRDPSSKH 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15539NP_001036776.1 P4Ha_N 33..156 CDD:285528
P4Hc 329..494 CDD:214780 48/158 (30%)
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927 20/107 (19%)
P4Hc 115..262 CDD:214780 48/156 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.