DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15539 and AT4G35810

DIOPT Version :9

Sequence 1:NP_001036776.1 Gene:CG15539 / 43627 FlyBaseID:FBgn0039782 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001320148.1 Gene:AT4G35810 / 829735 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana


Alignment Length:209 Identity:60/209 - (28%)
Similarity:105/209 - (50%) Gaps:22/209 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 MELLSLDPYMVLFHDVVSDKDIVSIRNLTKGKLARTVTVS-KDGNYTEDPDRTTKGTWLVE-NNA 374
            :|::|.:|...::|:.:::::...:.:|.|..:.::..|. |.|...:...||:.||:|.. ::.
plant    80 LEVISWEPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDVKTGKSIDSRVRTSSGTFLNRGHDE 144

  Fly   375 LIQRLSQLTQDMTNFDIHDADPFQVLNYGIGGFYGIHFD-FLEDAELDNFSDRIATAVFYLSDVP 438
            :::.:.....|.|.....:.:..|||:|.:|..|..|.| |.::..:.....||||.:.|||||.
plant   145 IVEEIENRISDFTFIPPENGEGLQVLHYEVGQRYEPHHDYFFDEFNVRKGGQRIATVLMYLSDVD 209

  Fly   439 QGGATIFP-------------------KLGLSVFPKKGSALLWYNLDHKGDGDNRTAHSACPTVV 484
            :||.|:||                   |.||||.|||..|||::::......|..:.|..||.:.
plant   210 EGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLDPSSLHGGCPVIK 274

  Fly   485 GSRWVMTKWINERE 498
            |::|..|||.:..|
plant   275 GNKWSSTKWFHVHE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15539NP_001036776.1 P4Ha_N 33..156 CDD:285528
P4Hc 329..494 CDD:214780 54/186 (29%)
AT4G35810NP_001320148.1 PLN00052 75..289 CDD:177683 60/209 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.