DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15539 and AT4G33910

DIOPT Version :9

Sequence 1:NP_001036776.1 Gene:CG15539 / 43627 FlyBaseID:FBgn0039782 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_567941.1 Gene:AT4G33910 / 829535 AraportID:AT4G33910 Length:288 Species:Arabidopsis thaliana


Alignment Length:214 Identity:59/214 - (27%)
Similarity:97/214 - (45%) Gaps:21/214 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 LAPLKMELLSLDPYMVLFHDVVSDKDIVSIRNLTKGKLARTVTVSKDGNYTEDP--DRTTKGTWL 369
            :..:..::||..|..:.|.:..:.:...:|....|..|..:....:.|...|:.  .||:.||::
plant    73 IGSIPFQVLSWRPRAIYFPNFATAEQCQAIIERAKVNLKPSALALRKGETAENTKGTRTSSGTFI 137

  Fly   370 ---VENNALIQRLSQLTQDMTNFDIHDADPFQVLNYGIGGFYGIHFDFLEDAEL-DNFSDRIATA 430
               .|:...:..:.:.....|.......:.|.:|.|.:|..|..|:|.....|. ...|.|||:.
plant   138 SASEESTGALDFVERKIARATMIPRSHGESFNILRYELGQKYDSHYDVFNPTEYGPQSSQRIASF 202

  Fly   431 VFYLSDVPQGGATIFP---------------KLGLSVFPKKGSALLWYNLDHKGDGDNRTAHSAC 480
            :.|||||.:||.|:||               .:||.|.|:||..||:|::...|..|..:.|.:|
plant   203 LLYLSDVEEGGETMFPFENGSNMGIGYDYKQCIGLKVKPRKGDGLLFYSVFPNGTIDQTSLHGSC 267

  Fly   481 PTVVGSRWVMTKWINEREQ 499
            |...|.:||.||||.:::|
plant   268 PVTKGEKWVATKWIRDQDQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15539NP_001036776.1 P4Ha_N 33..156 CDD:285528
P4Hc 329..494 CDD:214780 52/185 (28%)
AT4G33910NP_567941.1 PLN00052 66..287 CDD:177683 59/214 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.