DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15539 and AT3G28490

DIOPT Version :9

Sequence 1:NP_001036776.1 Gene:CG15539 / 43627 FlyBaseID:FBgn0039782 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_189490.2 Gene:AT3G28490 / 822479 AraportID:AT3G28490 Length:288 Species:Arabidopsis thaliana


Alignment Length:227 Identity:69/227 - (30%)
Similarity:114/227 - (50%) Gaps:22/227 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 LYCLYKTTSSYFLRLAPLKMELLSLDPYMVLFHDVVSDKDIVSIRNLTKGKLARTVTVSK-DGNY 356
            |..::...||:...:.|.::..||..|...|:...:||::...:..|.||||.:::.|:. |...
plant    13 LLLIFSQISSFSFSVDPTRITQLSWTPRAFLYKGFLSDEECDHLIKLAKGKLEKSMVVADVDSGE 77

  Fly   357 TEDPD-RTTKGTWLVE-NNALIQRLSQLTQDMTNFDIHDADPFQVLNYGIGGFYGIHFDFLEDAE 419
            :||.: ||:.|.:|.: .:.::..:.......|.....:.:..|:|:|..|..|..|||:..|.:
plant    78 SEDSEVRTSSGMFLTKRQDDIVANVEAKLAAWTFLPEENGEALQILHYENGQKYDPHFDYFYDKK 142

  Fly   420 -LDNFSDRIATAVFYLSDVPQGGATIFP------------------KLGLSVFPKKGSALLWYNL 465
             |:....||||.:.|||:|.:||.|:||                  |.|.:|.|:||.|||::||
plant   143 ALELGGHRIATVLMYLSNVTKGGETVFPNWKGKTPQLKDDSWSKCAKQGYAVKPRKGDALLFFNL 207

  Fly   466 DHKGDGDNRTAHSACPTVVGSRWVMTKWINER 497
            ...|..|..:.|.:||.:.|.:|..|:||:.|
plant   208 HLNGTTDPNSLHGSCPVIEGEKWSATRWIHVR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15539NP_001036776.1 P4Ha_N 33..156 CDD:285528
P4Hc 329..494 CDD:214780 58/186 (31%)
AT3G28490NP_189490.2 PLN00052 28..288 CDD:177683 66/212 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.