DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15539 and AT3G28480

DIOPT Version :9

Sequence 1:NP_001036776.1 Gene:CG15539 / 43627 FlyBaseID:FBgn0039782 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001189994.1 Gene:AT3G28480 / 822478 AraportID:AT3G28480 Length:324 Species:Arabidopsis thaliana


Alignment Length:247 Identity:71/247 - (28%)
Similarity:113/247 - (45%) Gaps:52/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 KTTSSYFLRLAPLKMELLSLDPYMVLFHDVVSDKDIVSIRNLTKGKLARTVTVSKD-GNYTEDPD 361
            ||::|.| ...|.::..||..|.:.|:...:||::......|.||||.:::....| |...|..|
plant    43 KTSASSF-GFDPTRVTQLSWTPRVFLYEGFLSDEECDHFIKLAKGKLEKSMVADNDSGESVESED 106

  Fly   362 RTTKGTWLVENNALIQRLSQLTQDMTNFDIHD-------------------ADPFQVLNYGIGGF 407
            ..          :::::.|....:|.:.:|.|                   .:..|:|:|..|..
plant   107 SV----------SVVRQSSSFIANMDSLEIDDIVSNVEAKLAAWTFLPEENGESMQILHYENGQK 161

  Fly   408 YGIHFDFLED-AELDNFSDRIATAVFYLSDVPQGGATIFP------------------KLGLSVF 453
            |..|||:..| |.|:....||||.:.|||:|.:||.|:||                  |.|.:|.
plant   162 YEPHFDYFHDQANLELGGHRIATVLMYLSNVEKGGETVFPMWKGKATQLKDDSWTECAKQGYAVK 226

  Fly   454 PKKGSALLWYNLDHKGDGDNRTAHSACPTVVGSRWVMTKWINER--EQIFRR 503
            |:||.|||::||......|:.:.|.:||.|.|.:|..|:||:.:  |:.|.:
plant   227 PRKGDALLFFNLHPNATTDSNSLHGSCPVVEGEKWSATRWIHVKSFERAFNK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15539NP_001036776.1 P4Ha_N 33..156 CDD:285528
P4Hc 329..494 CDD:214780 58/203 (29%)
AT3G28480NP_001189994.1 PLN00052 51..324 CDD:177683 67/238 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.