DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15539 and AT-P4H-1

DIOPT Version :9

Sequence 1:NP_001036776.1 Gene:CG15539 / 43627 FlyBaseID:FBgn0039782 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_181836.1 Gene:AT-P4H-1 / 818910 AraportID:AT2G43080 Length:283 Species:Arabidopsis thaliana


Alignment Length:211 Identity:62/211 - (29%)
Similarity:105/211 - (49%) Gaps:18/211 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 LRLAPLKMELLSLDPYMVLFHDVVSDKDIVSIRNLTKGKL-ARTVTVSKDGNYTEDPDRTTKGTW 368
            ||:..:|.|::|..|.:::.||.:|.::...::.:.:.:| ..||...|.|...:...||:.|.:
plant    70 LRIGNVKPEVVSWSPRIIVLHDFLSPEECEYLKAIARPRLQVSTVVDVKTGKGVKSDVRTSSGMF 134

  Fly   369 L--VENN-ALIQRLSQLTQDMTNFDIHDADPFQVLNYGIGGFYGIHFDFLEDA-ELDNFSDRIAT 429
            |  ||.: .:||.:.:.....:.....:.:..|||.|....||..|.|:..|. .|.....|:||
plant   135 LTHVERSYPIIQAIEKRIAVFSQVPAENGELIQVLRYEPQQFYKPHHDYFADTFNLKRGGQRVAT 199

  Fly   430 AVFYLSDVPQGGATIFP-----------KL--GLSVFPKKGSALLWYNLDHKGDGDNRTAHSACP 481
            .:.||:|..:||.|.||           |:  |:||.|.||.|:|::::...|..|.|:.|..|.
plant   200 MLMYLTDDVEGGETYFPLAGDGDCTCGGKIMKGISVKPTKGDAVLFWSMGLDGQSDPRSIHGGCE 264

  Fly   482 TVVGSRWVMTKWINER 497
            .:.|.:|..|||:.::
plant   265 VLSGEKWSATKWMRQK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15539NP_001036776.1 P4Ha_N 33..156 CDD:285528
P4Hc 329..494 CDD:214780 53/182 (29%)
AT-P4H-1NP_181836.1 PLN00052 80..281 CDD:177683 58/201 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.