DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15539 and p4htmb

DIOPT Version :9

Sequence 1:NP_001036776.1 Gene:CG15539 / 43627 FlyBaseID:FBgn0039782 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_001340234.2 Gene:p4htmb / 799930 ZFINID:ZDB-GENE-110131-7 Length:510 Species:Danio rerio


Alignment Length:257 Identity:64/257 - (24%)
Similarity:91/257 - (35%) Gaps:80/257 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 LDPYMVLFHDVVSDKDIVSIRNLTKGKLARTVTVSKDGNYTEDPD-------------------- 361
            |.|:.:|.|..|.|...::..||.  ::...:....|||.....:                    
Zfish   218 LQPHEILTHSRVRDGIWLTSENLK--EIYDGLKADLDGNGLLSLEEFGRLRSDAFQRFLLQRGVE 280

  Fly   362 -----RTTKGTWLVENNALIQRLSQLTQDMTNFD------IHDADPFQVLNYGIGGFYGIHFD-- 413
                 |.::.|||.:.....|.|..|.:.:|...      :..::|.||:.|..||.|..|.|  
Zfish   281 RSQLVRNSRHTWLYQGQGAHQVLQDLRKRVTLLTRLPSSLVELSEPLQVVRYEQGGHYHAHHDSG 345

  Fly   414 --FLEDA---------ELDNF--SDRIATAVFYLSDVPQGGATIFP------------------- 446
              :.|.|         ....|  |.|..|.:|||::|.:||.|.||                   
Zfish   346 PVYPETACTHTRLAANTTSPFQTSCRYITVLFYLNNVQEGGETTFPVADNRTYEEASLIQNDVDL 410

  Fly   447 --------KLGLSVFPKKGSALLWYNLDHKGDG-----DNRTAHSACPTVVGSRWVMTKWIN 495
                    |..|.|.|.||:|:.|||....|.|     |..:.|..|....|::||...|||
Zfish   411 LDTRKHCDKGNLRVKPVKGTAVFWYNYLSDGRGWVGEQDEYSLHGGCVVTQGTKWVANNWIN 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15539NP_001036776.1 P4Ha_N 33..156 CDD:285528
P4Hc 329..494 CDD:214780 56/242 (23%)
p4htmbXP_001340234.2 EF-hand_7 204..262 CDD:290234 11/45 (24%)
EFh 204..262 CDD:298682 11/45 (24%)
P4Hc 285..471 CDD:214780 50/185 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583457
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.