DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15539 and P4HTM

DIOPT Version :9

Sequence 1:NP_001036776.1 Gene:CG15539 / 43627 FlyBaseID:FBgn0039782 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_808807.2 Gene:P4HTM / 54681 HGNCID:28858 Length:563 Species:Homo sapiens


Alignment Length:467 Identity:99/467 - (21%)
Similarity:157/467 - (33%) Gaps:155/467 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 DVEEAIRGLRLIQWTYSLPTAEMAKGVLQD-----IHHNTSLDGMQCITIARHMVNYKDFIRAKE 188
            |.:..||.|.|....:.:|      |.|.|     |.|...:.|:|...|.              
Human   130 DRDHFIRTLSLKPLLFEIP------GFLTDEECRLIIHLAQMKGLQRSQIL-------------- 174

  Fly   189 WLMVGLKMYEADEEIEYIYSQLGMPLVDFYELF------------VEIQDELGSRYL----AMSE 237
                      ..||.|...|.:.:..:|.:.|.            |..|..||:.:.    ::.|
Human   175 ----------PTEEYEEAMSTMQVSQLDLFRLLDQNRDGHLQLREVLAQTRLGNGWWMTPESIQE 229

  Fly   238 LQLAIKNWPE---KVSLQRALSRLKMNIRIGKEPAEKKNKSKRVYKKCCSSECRPTAKLY----- 294
            :..|||..|:   .:|||                 |..|...|.:.|...|....:::|.     
Human   230 MYAAIKADPDGDGVLSLQ-----------------EFSNMDLRDFHKYMRSHKAESSELVRNSHH 277

  Fly   295 -CLYKTTSSY---------FLRLAPLKMELLSL-DPYMVL-------FHDVVSDKDIVSIRNLTK 341
             .||:...::         .|||..|..|::.| :|..|:       :|..|....:......:.
Human   278 TWLYQGEGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSH 342

  Fly   342 GKLARTVTVSKDGNYTEDPDRTTKGTWLVENNALIQRLSQLTQDMTNFDIHDADPFQV---LNYG 403
            .||     |:.:....|...|.....|.:.  ::::..:.:||         |.|..|   |..|
Human   343 TKL-----VANESVPFETSCRQVSPNWGLP--SILRPGTPMTQ---------AQPCTVGVPLGMG 391

  Fly   404 IGGFYGIHFDFLEDAELDNFS-----DRIATAVFYLSDVPQGGATIFP----------------- 446
            .|..:.|.....|..:|...|     ....|.:|||::|..||.|:||                 
Human   392 PGDHWVIPVSPWEHPQLGTCSVPPLPYSYMTVLFYLNNVTGGGETVFPVADNRTYDEMSLIQDDV 456

  Fly   447 ----------KLGLSVFPKKGSALLWYNLDHKGDG-----DNRTAHSACPTVVGSRWVMTKWIN- 495
                      |..|.|.|::|:|:.|||....|.|     |:.:.|..|....|::|:...||| 
Human   457 DLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGDVDDYSLHGGCLVTRGTKWIANNWINV 521

  Fly   496 ----EREQIFRR 503
                .|:.:|::
Human   522 DPSRARQALFQQ 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15539NP_001036776.1 P4Ha_N 33..156 CDD:285528 7/26 (27%)
P4Hc 329..494 CDD:214780 44/204 (22%)
P4HTMNP_808807.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..111
EF-hand_7 192..252 CDD:290234 15/76 (20%)
EFh 194..252 CDD:238008 14/74 (19%)
P4Hc 246..519 CDD:214780 64/305 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149314
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.