DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15539 and P4HA1

DIOPT Version :9

Sequence 1:NP_001036776.1 Gene:CG15539 / 43627 FlyBaseID:FBgn0039782 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_000908.2 Gene:P4HA1 / 5033 HGNCID:8546 Length:534 Species:Homo sapiens


Alignment Length:560 Identity:172/560 - (30%)
Similarity:268/560 - (47%) Gaps:91/560 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILYLLV----LVKSHSKPKILENNYAISIYDMSKLIDYEHYLLNILQKFANALQKRVDTLEYYLE 70
            |.|:|:    |.:|.:.|     .:..||..|:.||..|..|:..|:.:..|.:.:::.::.:.|
Human     2 IWYILIIGILLPQSLAHP-----GFFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAE 61

  Fly    71 MTD-------YDREKNLAEDPIKHFRITRRLHSDYVNWVWFMEEQPWGTL----VKDI------- 117
            ..|       .|.| .....|:..|::.:||:::            |..|    :||:       
Human    62 KLDRLTSTATKDPE-GFVGHPVNAFKLMKRLNTE------------WSELENLVLKDMSDGFISN 113

  Fly   118 IAIAPE-MPTLKDVEEAIRGLRLIQWTYSLPTAEMAKGVLQDIHHNTSLDGMQCITIARHMVNYK 181
            :.|..: .|..:|...|.:.|..:|.||:|.|..::||.|..:.|.:.|....|..:.:......
Human   114 LTIQRQYFPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDCFELGKVAYTEA 178

  Fly   182 DFIRAKEWLMVGLKMYEADE-EIEYIYSQLGMPLVDFYELFVEIQDELGSRYLAMSELQLAIKNW 245
            |:...:.|:...|:  :.|| ||..|..   :.::|:....|..|.:|....|...:|   ::..
Human   179 DYYHTELWMEQALR--QLDEGEISTIDK---VSVLDYLSYAVYQQGDLDKALLLTKKL---LELD 235

  Fly   246 PEKVSLQRALSRLK-----------MNIRIGKEPAEKKNKSKR------------VYKKCCSSE- 286
            ||.   |||...||           :|.....:.:::|...|:            .|:..|..| 
Human   236 PEH---QRANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEG 297

  Fly   287 ----CRPTAKLYCLYK--TTSSYFLRLAPLKMELLSLDPYMVLFHDVVSDKDIVSIRNLTKGKLA 345
                .|...||:|.|.  ..:..|: |||.|.|.....|.::.|||::||.:|..:::|.|.:|:
Human   298 IKMTPRRQKKLFCRYHDGNRNPKFI-LAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRLS 361

  Fly   346 R-TVTVSKDGNYTEDPDRTTKGTWLV-ENNALIQRLSQLTQDMTNFDIHDADPFQVLNYGIGGFY 408
            | ||...:.|..|....|.:|..||. ..|.::.|::...||:|..|:..|:..||.|||:||.|
Human   362 RATVHDPETGKLTTAQYRVSKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANYGVGGQY 426

  Fly   409 GIHFDFLEDAELDNFSD-----RIATAVFYLSDVPQGGATIFPKLGLSVFPKKGSALLWYNLDHK 468
            ..||||....|.|.|.:     ||||.:||:|||..||||:||::|.||:||||:|:.||||...
Human   427 EPHFDFARKDEPDAFKELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFAS 491

  Fly   469 GDGDNRTAHSACPTVVGSRWVMTKWINEREQIFRRPCLTS 508
            |:||..|.|:|||.:||::||..||::||.|.|||||..|
Human   492 GEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPCTLS 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15539NP_001036776.1 P4Ha_N 33..156 CDD:285528 33/141 (23%)
P4Hc 329..494 CDD:214780 77/171 (45%)
P4HA1NP_000908.2 P4Ha_N 25..112 CDD:400573 20/99 (20%)
TPR 205..238 7/35 (20%)
P4Hc 345..518 CDD:214780 78/172 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.