DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15539 and phy-4

DIOPT Version :9

Sequence 1:NP_001036776.1 Gene:CG15539 / 43627 FlyBaseID:FBgn0039782 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001123049.1 Gene:phy-4 / 189869 WormBaseID:WBGene00012815 Length:282 Species:Caenorhabditis elegans


Alignment Length:239 Identity:67/239 - (28%)
Similarity:121/239 - (50%) Gaps:31/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 RVYKKCCSSECRPTA----KLYCLYKTTSSYFLRLAPLKMELLSLDPYMVLFHDVVSDKDIVSIR 337
            :::.| |..|.|..:    :|.| |:......:|    |:|:||.:|:::.:|:.|.       |
 Worm    31 KIWDK-CGKELRGDSSRDGRLVC-YRLHKHLLIR----KVEILSSEPFILQYHNQVH-------R 82

  Fly   338 NLTKGKL----ARTVTVSKDGNYTEDPD----RTTKGTWLVENN--ALIQRLSQLTQDMTNFDIH 392
            .|.|..:    |..:...|...:|..|:    |...||||:...  :..:....|..::.:.|:.
 Worm    83 RLAKRAVQEAEALRLEQLKISGFTTTPEKSQVRAANGTWLIHTGRPSFARIFEGLQANINSLDLS 147

  Fly   393 DADPFQVLNYGIGGFYGIHFDFLEDAE----LDNFSDRIATAVFYLSDVPQGGATIFPKLGLSVF 453
            .|:|:|:|:|...|:|..|:|:|..|.    ::...:||||.:..|....:||.|:||:|.|::.
 Worm   148 TAEPWQILSYNADGYYAPHYDYLNPATNVQLVEGRGNRIATVLVILQIAKKGGTTVFPRLNLNIR 212

  Fly   454 PKKGSALLWYNLDHKGDGDNRTAHSACPTVVGSRWVMTKWINER 497
            ||.|..::|.|....|:.:::|.|:|||...|::...|.|::|:
 Worm   213 PKAGDVIVWLNTLSTGESNSQTLHAACPIHEGTKIGATLWVHEK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15539NP_001036776.1 P4Ha_N 33..156 CDD:285528
P4Hc 329..494 CDD:214780 50/178 (28%)
phy-4NP_001123049.1 P4Hc 81..254 CDD:214780 51/179 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.