DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31371 and AT1G20270

DIOPT Version :9

Sequence 1:NP_733375.2 Gene:CG31371 / 43626 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:208 Identity:42/208 - (20%)
Similarity:74/208 - (35%) Gaps:69/208 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 EPVSSDPYIVLHHDVLTPKESNELLQL----------IDEEEDTKGVSYQSL------------- 365
            |.:|.:|...::|:.|:.:|...|:.|          :|.|   .|.|..|.             
plant    77 EVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVDSE---TGKSKDSRVRTSSGTFLRRGR 138

  Fly   366 -KLSKLAQKKLGRISRL-----LGLEILELDPWTGRR---HGHEHITKLEHSSELKHVARLMLNL 421
             |:.|..:|::...:.:     .||::|..:  .|::   |....:.:....:..:.:|.:::.|
plant   139 DKIIKTIEKRIADYTFIPADHGEGLQVLHYE--AGQKYEPHYDYFVDEFNTKNGGQRMATMLMYL 201

  Fly   422 QAPGMGGAVVFPQLELAVNV----------------------PR--GSLLHWRTRFAGGSSSEWD 462
            .....||..|||    |.|:                      ||  .:||.|..|    ..:..|
plant   202 SDVEEGGETVFP----AANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMR----PDATLD 258

  Fly   463 YRSGQAICPVLLG 475
            ..|....|||:.|
plant   259 PTSLHGGCPVIRG 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 41/206 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.