DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31371 and AT5G66060

DIOPT Version :9

Sequence 1:NP_733375.2 Gene:CG31371 / 43626 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_201407.4 Gene:AT5G66060 / 836738 AraportID:AT5G66060 Length:289 Species:Arabidopsis thaliana


Alignment Length:217 Identity:40/217 - (18%)
Similarity:73/217 - (33%) Gaps:91/217 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 LEPVSSDPYIVLHHDVLTPKESNELLQL----------IDEE----EDTKGVSYQSLKLSKLAQK 373
            :|.:|.:|...::|:.||.:|...|::|          :||:    .|::..:.....|::...|
plant    78 VEIISWEPRASVYHNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVRTSSGTFLARGRDK 142

  Fly   374 KLGRISRLL------------GLEILE--------------LDPWTGRRHGHEHITKLEHSSELK 412
            .:..|.:.:            ||::|.              :|.:..|..|....|.|.:.|:::
plant   143 TIREIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLMYLSDVE 207

  Fly   413 HVARLMLNLQAPGMGGAVVFPQLE-------------------LAVNVPRG-SLLHWR------- 450
            .             ||..|||..:                   |:|....| :||.|.       
plant   208 E-------------GGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATL 259

  Fly   451 --TRFAGG---------SSSEW 461
              :...||         ||::|
plant   260 DPSSLHGGCAVIKGNKWSSTKW 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
AT5G66060NP_201407.4 PLN00052 74..288 CDD:177683 40/217 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.