DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31371 and AT4G35820

DIOPT Version :9

Sequence 1:NP_733375.2 Gene:CG31371 / 43626 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:251 Identity:51/251 - (20%)
Similarity:86/251 - (34%) Gaps:83/251 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 EQLLIEEICRGAKQQVTTGSRFNHCQLDGSSPWL-------------LLQPSR--LEPVSSDPYI 332
            ::|:.|::....|.:..|......|.|   ||.|             |..|:.  ||.::.:|..
plant    36 DELVGEQVSVDVKIEEKTKDMILLCSL---SPLLTTLTCSMVKVAASLRFPNERWLEVITKEPRA 97

  Fly   333 VLHHDVL--------TPKESNELLQLIDEEEDTKGVSYQSLKLSKLAQKKLGRISRLLGLE-ILE 388
            .::|:.|        |.:|.:.|:               ||....:|:.|:......||.| ...
plant    98 FVYHNFLALFFKICKTNEECDHLI---------------SLAKPSMARSKVRNALTGLGEESSSR 147

  Fly   389 LDPWTGRRHGHEHITK-LE------------------------------HSSELKHVARLMLNLQ 422
            ....|..|.||:.|.| :|                              |....:.:|.:::.|.
plant   148 TSSGTFIRSGHDKIVKEIEKRISEFTFIPQENGETLQVINYEVGQKFEPHFDGFQRIATVLMYLS 212

  Fly   423 APGMGGAVVFPQLE-------LAVNVPRG-SLLHWRTRFAGGSSSEWDYRSGQAIC 470
            ....||..|||:.:       ::|...:| :||.|..|..|  |.:...:.|:..|
plant   213 DVDKGGETVFPEAKGIKSKKGVSVRPKKGDALLFWSMRPDG--SRDPSSKHGKRHC 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927 9/43 (21%)
P4Hc 115..262 CDD:214780 32/163 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.