DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31371 and AT4G35810

DIOPT Version :9

Sequence 1:NP_733375.2 Gene:CG31371 / 43626 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001320148.1 Gene:AT4G35810 / 829735 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana


Alignment Length:202 Identity:43/202 - (21%)
Similarity:74/202 - (36%) Gaps:55/202 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 LEPVSSDPYIVLHHDVLTPKESNELLQL------------------IDEEEDTKGVSYQSLKLSK 369
            ||.:|.:|...::|:.||.:|...|:.|                  ||....|...::.:....:
plant    80 LEVISWEPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDVKTGKSIDSRVRTSSGTFLNRGHDE 144

  Fly   370 LAQKKLGRISRLL--------GLEILELDPWTGRRHGHEHITKLEHSSELK---HVARLMLNLQA 423
            :.::...|||...        ||::|..:  .|:|:...|....:..:..|   .:|.:::.|..
plant   145 IVEEIENRISDFTFIPPENGEGLQVLHYE--VGQRYEPHHDYFFDEFNVRKGGQRIATVLMYLSD 207

  Fly   424 PGMGGAVVFPQLELAV-NVP-------------------RGSLLHWRTRFAGGSSSEWDYRSGQA 468
            ...||..|||..:..| :||                   |.:||.|..:    ..:..|..|...
plant   208 VDEGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMK----PDASLDPSSLHG 268

  Fly   469 ICPVLLG 475
            .|||:.|
plant   269 GCPVIKG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
AT4G35810NP_001320148.1 PLN00052 75..289 CDD:177683 43/202 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.