DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31371 and p4htma

DIOPT Version :9

Sequence 1:NP_733375.2 Gene:CG31371 / 43626 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001074160.1 Gene:p4htma / 791209 ZFINID:ZDB-GENE-070112-2222 Length:478 Species:Danio rerio


Alignment Length:215 Identity:49/215 - (22%)
Similarity:83/215 - (38%) Gaps:48/215 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 RVHILEATLNIEYRAGELSRA------------LATAEELLLLLPMNQGIQKAKRKIEKAMAKKE 263
            |:||.::::        .|||            :.....|||.:..|.|..:....:||:     
Zfish    30 RIHIQKSSV--------CSRAYFVVVMAFFHLYIINIIALLLYVHYNTGSGEQDVPLEKS----- 81

  Fly   264 LPKGRGQKSKAKKQISKSTEQLLIEEICRGAKQQVTTGSRFNHCQLDGSSPWLLLQPSR---LEP 325
              .|..:...|:.|...||..|..|...:..:.:   |.|..|.|.      :.:.|.|   :..
Zfish    82 --AGSPRAVPAEHQTPSSTAHLSPEMSFQLPRLE---GIRVGHVQR------VSIVPDRTHNMRT 135

  Fly   326 VSSDPYIVLHHDVLTPKESNELLQLIDEEEDTKGVSYQSLKLSKLAQKKLGRISRLLGLEILELD 390
            :|..|.:......|:.:|||.::||    ...||:::.||..:...:::|.: ..|..|..|..|
Zfish   136 LSLKPLLFEIPGFLSVEESNVVMQL----AQLKGLTHSSLLTNPDQEEQLTQ-DELFSLLDLNQD 195

  Fly   391 PWTGRRHGHEHITKLEHSSE 410
            ....|    |.|..|.||::
Zfish   196 GLLQR----EEILSLSHSTD 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
p4htmaNP_001074160.1 2OG-FeII_Oxy <272..442 CDD:304390
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583479
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.