DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31371 and Y43F8B.19

DIOPT Version :9

Sequence 1:NP_733375.2 Gene:CG31371 / 43626 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001123044.2 Gene:Y43F8B.19 / 6418801 WormBaseID:WBGene00077688 Length:243 Species:Caenorhabditis elegans


Alignment Length:227 Identity:52/227 - (22%)
Similarity:85/227 - (37%) Gaps:63/227 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 RLEPVSSDPYIVLHHDVLTPKESNELLQLID----EEEDTKGVSYQSLKLSKLAQKKLGRISRLL 382
            ::|.|:..|.:|::.|:.|.|:..:.|:|::    ||:         |.::......:.:|.|..
 Worm    23 KVEVVAWRPGLVIYRDLFTGKQVRDHLELMEHLKFEEQ---------LVVNDDGNDIVSKIRRAN 78

  Fly   383 GLEILELDP------WTGRRH---------------------GH--EHITKLEHSSELK------ 412
            |.::...|.      |...::                     ||  .|...|.:.||.:      
 Worm    79 GTQVFHEDHPAARSIWDTAKNLLPNLNFKTAEDILALSYNPGGHYAAHHDYLLYPSEKEWDEWMR 143

  Fly   413 ----HVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVL 473
                ....|::...|...|||.|||:|..||....|....|   |....:||.:..|..|.||:.
 Worm   144 VNGNRFGTLIMAFGAAESGGATVFPRLGAAVRTKPGDAFFW---FNAMGNSEQEDLSEHAGCPIY 205

  Fly   474 LG-VQLSVIACQSN---VLRDTLYGPRGQDSI 501
            .| .|:|.|..:..   :|..||    ..||:
 Worm   206 KGQKQISTIWLRMRDQPILEQTL----SSDSL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
Y43F8B.19NP_001123044.2 P4Hc 43..217 CDD:214780 41/185 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.