DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31371 and PH4alphaNE3

DIOPT Version :9

Sequence 1:NP_733375.2 Gene:CG31371 / 43626 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster


Alignment Length:520 Identity:125/520 - (24%)
Similarity:218/520 - (41%) Gaps:109/520 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFLLVESVAGANFARGEEQLQALLDTET----------QLIDGLRDYIERLERQLEEIRRETSAI 67
            :|..|||.  .|:    |..|..||||:          :|||.|.:|.|:::.:..:::|....:
  Fly     1 MFCKVEST--LNW----ESRQEFLDTESAKMDLMQLDVELIDNLMNYAEKIDEKASQLKRLAQEL 59

  Fly    68 EE-IHSQVDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGER----LSDRQLTLPSE 127
            .: :||.....|||:||||:.|.:::.....|..||:    .::...||.    |..:...||.:
  Fly    60 RQPLHSAKGREEEYLGNPLHSFPLIRHMYQDWRYLEE----FMKKPVGEEEIQFLRRKLPELPWQ 120

  Fly   128 EDYEESLNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVARK----SDFPVARFWLES 188
            .|.||:...:..:...|.:....::.|:::..:..|::...||.|||:.    ..|..|..|:..
  Fly   121 VDTEEASVSIFRIAETYGMMPWDMANGLIDNVRFNSTLPALDCFEVAKMYFKWGYFKQALQWITI 185

  Fly   189 ALEKLPSASENSTESQRERESG----------RVHILEATLNIEY-RAGELSRALATAEELLLLL 242
            :..::           :|..||          .|.:|:|...:|. |..|       |.|:||..
  Fly   186 SKARM-----------KEEYSGVYEVLGMNRQDVALLQARCLVELDRRDE-------AHEVLLDQ 232

  Fly   243 P--MNQGIQKAKR-KIEKAMAKKELPK-GRGQKSKAKKQISKSTEQLLIEEICRGAKQQVTTGSR 303
            |  .:..|....: |.....|....|| |.|.|...:...|.:..:|                  
  Fly   233 PDLADNSISLLDQFKANPYEAIDSSPKLGEGYKRLCRSSFSPNPSKL------------------ 279

  Fly   304 FNHCQLDG-SSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELL----------QLIDEEEDT 357
              ||:.:. :|.:|:|.|.::|.:|.:|:||::||:|..|:..:|:          ::.|:.::.
  Fly   280 --HCRYNSTTSAFLILAPLKMEEISLEPHIVVYHDILPDKDIQQLITLAEPLLKPTEMFDDNKNE 342

  Fly   358 KGVSYQSLKLSKLAQKKLGRISRLLGLEILELDPWTGRRHG--------HEHITKLEHSSELK-- 412
            ...||::.....|......|:..:.||:|.:.:|....::|        ::...|  .:||.|  
  Fly   343 ARSSYRTPLGGPLLDSLTQRMRDITGLQIRQGNPINIIKYGFGAPYTNYYDFFKK--RNSESKGF 405

  Fly   413 --HVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLG 475
              .:|..|..|.....|||.|||:|.:.|...||.:|.|..  ..|.:.:.:..:..|.|||..|
  Fly   406 GDRMATFMFYLNDAPYGGATVFPRLNVKVPAERGKVLFWYN--LNGDTHDMEPTTMHAACPVFHG 468

  Fly   476  475
              Fly   469  468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 36/140 (26%)
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528 30/127 (24%)
P4Hc 316..478 CDD:214780 37/157 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461801
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X129
65.840

Return to query results.
Submit another query.