DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31371 and P4htm

DIOPT Version :9

Sequence 1:NP_733375.2 Gene:CG31371 / 43626 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:326 Identity:68/326 - (20%)
Similarity:121/326 - (37%) Gaps:97/326 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 SGRVHILEATLNIEYRAGELSRALATAE-ELLLLLPMNQGIQKAKRKIEKAMAKKELPKGRGQKS 272
            :||.|.:. ||:::....|:...|:..| .|::.|...:|:|::          :.||....:::
  Rat   130 AGRDHFIR-TLSLKPLLFEIPGFLSDEECRLIIHLAQMKGLQRS----------QILPTEEYEEA 183

  Fly   273 KAKKQISKSTEQLLIEEICRGAKQ--QVTTGSRFNHCQLDGSSPWLLLQPSRLEPVSSDPYIVLH 335
            .:..::|:.....|:::...|..|  :|...:|.      |:..|                    
  Rat   184 MSAMRVSQLDLFQLLDQNHDGRLQLREVLAQTRL------GNGRW-------------------- 222

  Fly   336 HDVLTPKESNELLQLIDEEEDTKGV-SYQSLKLSKLAQKKLGRISRLLGLEILEL-----DPWTG 394
               :||:...|:...|..:.|..|| |.|  :.|.:..:...:..|....|..||     ..|..
  Rat   223 ---MTPENIQEMYSAIKADPDGDGVLSLQ--EFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLH 282

  Fly   395 RRHGHEHITKLEHSSELKHVARL---MLNLQAP------GMGG--------AVVFPQ-----LEL 437
            :..|..|:.:......|: :.||   ::.|..|      |.||        ..|:|:     .:|
  Rat   283 QGEGAHHVMRAIRQRVLR-LTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETVCSHTKL 346

  Fly   438 AVN--VP------RGSLLHWRTRFAGGSSSEWDYRSGQAICPVL---LGVQLSVIACQSNV-LRD 490
            ..|  ||      ..::|.:.....||         |:.:.||.   ...::|:|  |.|| |||
  Rat   347 VANESVPFETSCRYMTVLFYLNNVTGG---------GETVFPVADNRTYDEMSLI--QDNVDLRD 400

  Fly   491 T 491
            |
  Rat   401 T 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 17/90 (19%)
P4Hc 247..459 CDD:214780 38/169 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343186
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.