DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31371 and P4HA3

DIOPT Version :9

Sequence 1:NP_733375.2 Gene:CG31371 / 43626 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001275677.1 Gene:P4HA3 / 283208 HGNCID:30135 Length:604 Species:Homo sapiens


Alignment Length:550 Identity:139/550 - (25%)
Similarity:211/550 - (38%) Gaps:137/550 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ARGE-----EQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEEIHSQVDSVEEYMGNPL 85
            |||:     ..:...|..|.:|:..||.|:...|.:|.::.|....:..:|.  ||... :.|||
Human    26 ARGDTFSALTSVARALAPERRLLGLLRRYLRGEEARLRDLTRFYDKVLSLHE--DSTTP-VANPL 87

  Fly    86 NVFGILKRFESVWPGLEQKANATLEMVFGERLSDR----QLTLPSEEDYEESLNHLLHLQSVYEL 146
            ..|.::||.:|.|..:.....|:..:   ..|.|.    :..||:.||.|.:...|:.||.||.|
Human    88 LAFTLIKRLQSDWRNVVHSLEASENI---RALKDGYEKVEQDLPAFEDLEGAARALMRLQDVYML 149

  Fly   147 DSNSLSLGV---VNGFKLGS--------SMSWGDCLEVAR----KSDFPVARFWLESALEKL-PS 195
            :...|:.||   |.|..:..        |::..||.:|.:    ..|:..|..|||.|:... .|
Human   150 NVKGLARGVFQRVTGSAITDLYSPKRLFSLTGDDCFQVGKVAYDMGDYYHAIPWLEEAVSLFRGS 214

  Fly   196 ASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIEKAMA 260
            ..|..||.:...|....|:..|    .:|||.:|.||:.:.|.||..|.|           |.||
Human   215 YGEWKTEDEASLEDALDHLAFA----YFRAGNVSCALSLSREFLLYSPDN-----------KRMA 264

  Fly   261 KKELPKGRGQKSKAKKQISKSTEQLLIEEICR--GAKQQVTTGSRFNHCQLDGSSP--------- 314
            :..|        |.::.:::|...::.|.:.:  ......|..:....||..||.|         
Human   265 RNVL--------KYERLLAESPNHVVAEAVIQRPNIPHLQTRDTYEGLCQTLGSQPTLYQIPSLY 321

  Fly   315 ---------WLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQL---------IDEEEDTKGVS 361
                     :|||||.|.|.:..:|||.|:||.::..|:.::.:|         :...|....|.
Human   322 CSYETNSNAYLLLQPIRKEVIHLEPYIALYHDFVSDSEAQKIRELAEPWLQRSVVASGEKQLQVE 386

  Fly   362 YQSLK---LSKLAQKKL----GRISRLLGLEILELDPWT-----------GRRHGH-EHITKLEH 407
            |:..|   |......||    .||:.|.||::  ..|:.           |....| :|.|  ..
Human   387 YRISKSAWLKDTVDPKLVTLNHRIAALTGLDV--RPPYAEYLQVVNYGIGGHYEPHFDHAT--SP 447

  Fly   408 SSEL------KHVARLMLNLQAPGMGGAVVFPQLELAVNVPR------------GSLLH------ 448
            ||.|      ..||..|:.|.:...|||..|....|:|.|.|            |::.|      
Human   448 SSPLYRMKSGNRVATFMIYLSSVEAGGATAFIYANLSVPVVRHCFGGTCTGVVKGTVTHFMLAVL 512

  Fly   449 --WRTRFAGGSSSEW---DYRSGQAICPVL 473
              |  ..:|..:|.:   |..|.....|.|
Human   513 SWW--EISGWPTSGYMSMDRNSADPAAPAL 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 37/132 (28%)
P4HA3NP_001275677.1 P4Ha_N 58..159 CDD:285528 30/106 (28%)
TPR_12 186..252 CDD:290160 20/69 (29%)
P4Hc 356..>478 CDD:214780 29/125 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149283
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.700

Return to query results.
Submit another query.