DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31371 and phy-3

DIOPT Version :9

Sequence 1:NP_733375.2 Gene:CG31371 / 43626 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_507251.2 Gene:phy-3 / 188624 WormBaseID:WBGene00004026 Length:318 Species:Caenorhabditis elegans


Alignment Length:196 Identity:39/196 - (19%)
Similarity:75/196 - (38%) Gaps:50/196 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 PSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTK-------GVSYQ-------------- 363
            |..:|.:|..|.:|::.::::|:::...|..| |:.|.:       |.|.:              
 Worm    82 PVDMEIISWAPTLVIYRNLMSPRQTASFLNFI-EQRDLEIQKTSDFGTSIETTHRRANGSFIPPE 145

  Fly   364 ----SLKLSKLAQKKLGRISRLLGLEILELDPWTGRRH---GH--EHITKLEHSSELKH------ 413
                ::::...|||      |:.||.:...:.::...:   ||  .|...|::.|:..:      
 Worm   146 DSNVTVEIKMQAQK------RIPGLNLTVAEHFSALSYLPGGHYAVHYDYLDYRSKQDYDWWMNK 204

  Fly   414 ----VARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLL 474
                :..|:..|:....||..|||.:...|....|....|   |...:..|.:..|....||:..
 Worm   205 TGNRIGTLIFVLKPAEKGGGTVFPSIGSTVRANAGDAFFW---FNAQADEEKEMLSNHGGCPIYE 266

  Fly   475 G 475
            |
 Worm   267 G 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
phy-3NP_507251.2 P4Hc 102..277 CDD:214780 34/176 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.