DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE1 and AT5G66060

DIOPT Version :9

Sequence 1:NP_733374.1 Gene:PH4alphaNE1 / 43625 FlyBaseID:FBgn0039780 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_201407.4 Gene:AT5G66060 / 836738 AraportID:AT5G66060 Length:289 Species:Arabidopsis thaliana


Alignment Length:206 Identity:66/206 - (32%)
Similarity:102/206 - (49%) Gaps:22/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 SLDPYVATFHDILSPGKISQLREMAVPRMHRSTVNPLPGGQLKKSAFRVSKNAWLAYESHPTMVG 392
            |.:|..:.:|:.|:..:...|.|:|.|.|.:|||.....|:...|..|.|...:||.....|:..
plant    82 SWEPRASVYHNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVRTSSGTFLARGRDKTIRE 146

  Fly   393 MLRDLKDATGLDTTFCEQLQVANYGVGGHYEPHWDFFRDPNHYPAEEGNRIATAIFYLSEVEQGG 457
            :.:.:.|.|.:.....|.|||.:|.:|..||||:|:|.| .:.....|.||||.:.|||:||:||
plant   147 IEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMD-EYNTRNGGQRIATVLMYLSDVEEGG 210

  Fly   458 ATAFPFL-------------------DIAVKPQLGNVLFWYNLHRSLDKDYRTKHAGCPVLKGSK 503
            .|.||..                   .::|||::|:.|.::::......|..:.|.||.|:||:|
plant   211 ETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGCAVIKGNK 275

  Fly   504 WIGNVW--IHE 512
            |....|  :||
plant   276 WSSTKWLRVHE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE1NP_733374.1 P4Ha_N 26..155 CDD:285528
P4Hc 341..511 CDD:214780 60/190 (32%)
AT5G66060NP_201407.4 PLN00052 74..288 CDD:177683 66/206 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.