DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE1 and AT5G18900

DIOPT Version :9

Sequence 1:NP_733374.1 Gene:PH4alphaNE1 / 43625 FlyBaseID:FBgn0039780 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_197391.1 Gene:AT5G18900 / 832008 AraportID:AT5G18900 Length:298 Species:Arabidopsis thaliana


Alignment Length:215 Identity:64/215 - (29%)
Similarity:98/215 - (45%) Gaps:22/215 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 FLAPLKLEEHSLDPYVATFHDILSPGKISQLREMAVPRMHRSTVNPLPGGQLKKSAFRVSKNAWL 382
            |:.|.|:::.|..|....:...|:..:...:..:|...:.||.|.....|:.|.|..|.|...::
plant    31 FVNPSKVKQVSSKPRAFVYEGFLTELECDHMVSLAKASLKRSAVADNDSGESKFSEVRTSSGTFI 95

  Fly   383 AYESHPTMVGMLRDLKDATGLDTTFCEQLQVANYGVGGHYEPHWDFFRDPNHYPAEEGNRIATAI 447
            :....|.:.|:...:...|.|.....|.:||..|..|..|:.|:|:|.|..:. ...|:|:||.:
plant    96 SKGKDPIVSGIEDKISTWTFLPKENGEDIQVLRYEHGQKYDAHFDYFHDKVNI-VRGGHRMATIL 159

  Fly   448 FYLSEVEQGGATAFPFLD---------------------IAVKPQLGNVLFWYNLHRSLDKDYRT 491
            .|||.|.:||.|.||..:                     |||||:.|:.|.::|||.....|..:
plant   160 MYLSNVTKGGETVFPDAEIPSRRVLSENKEDLSDCAKRGIAVKPRKGDALLFFNLHPDAIPDPLS 224

  Fly   492 KHAGCPVLKGSKWIGNVWIH 511
            .|.||||::|.||....|||
plant   225 LHGGCPVIEGEKWSATKWIH 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE1NP_733374.1 P4Ha_N 26..155 CDD:285528
P4Hc 341..511 CDD:214780 56/190 (29%)
AT5G18900NP_197391.1 PLN00052 33..298 CDD:177683 63/213 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.