DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE1 and AT3G28490

DIOPT Version :9

Sequence 1:NP_733374.1 Gene:PH4alphaNE1 / 43625 FlyBaseID:FBgn0039780 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_189490.2 Gene:AT3G28490 / 822479 AraportID:AT3G28490 Length:288 Species:Arabidopsis thaliana


Alignment Length:237 Identity:71/237 - (29%)
Similarity:107/237 - (45%) Gaps:31/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 PLKLEEHSLDPYVATFHDILSPGKISQLREMAVPRMHRS-TVNPLPGGQLKKSAFRVSKNAWLAY 384
            |.::.:.|..|....:...||..:...|.::|..::.:| .|..:..|:.:.|..|.|...:|..
plant    29 PTRITQLSWTPRAFLYKGFLSDEECDHLIKLAKGKLEKSMVVADVDSGESEDSEVRTSSGMFLTK 93

  Fly   385 ESHPTMVGMLRDLKDATGLDTTFCEQLQVANYGVGGHYEPHWDFFRDPNHYPAEE--GNRIATAI 447
            .....:..:...|...|.|.....|.||:.:|..|..|:||:|:|.|..   |.|  |:||||.:
plant    94 RQDDIVANVEAKLAAWTFLPEENGEALQILHYENGQKYDPHFDYFYDKK---ALELGGHRIATVL 155

  Fly   448 FYLSEVEQGGATAFP--------FLD----------IAVKPQLGNVLFWYNLHRSLDKDYRTKHA 494
            .|||.|.:||.|.||        ..|          .||||:.|:.|.::|||.:...|..:.|.
plant   156 MYLSNVTKGGETVFPNWKGKTPQLKDDSWSKCAKQGYAVKPRKGDALLFFNLHLNGTTDPNSLHG 220

  Fly   495 GCPVLKGSKWIGNVWIHEVTQTFARP---CDVFRDHEVSLEY 533
            .|||::|.||....|||  .::|.:.   |  ..|||...|:
plant   221 SCPVIEGEKWSATRWIH--VRSFGKKKLVC--VDDHESCQEW 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE1NP_733374.1 P4Ha_N 26..155 CDD:285528
P4Hc 341..511 CDD:214780 59/190 (31%)
AT3G28490NP_189490.2 PLN00052 28..288 CDD:177683 71/237 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.